Defensin HNP-1 (human) trifluoroacetate salt,CAS : 148093-65-6
H-Ala-Cys-Tyr-Cys-Arg-Ile-Pro-Ala-Cys-Ile-Ala-Gly-Glu-Arg-Arg-Tyr-Gly-Thr-Cys-Ile-Tyr-Gln-Gly-Arg-Leu-Trp-Ala-Phe-Cys-Cys-OH trifluoroacetate salt (Disulfide bonds between Cys² and Cys³⁰/Cys⁴ and Cys¹⁹/Cys⁹ and Cys²⁹)
Catalog # | Pkg Size | Price(USD) | Quantity | Buy this product |
---|---|---|---|---|
R-M-821 | 0.1mg | 130.00 | + Add to cart |
|
R-M-821 | 0.5mg | 540.00 | + Add to cart |
|
R-M-821 | 1mg | 1030.00 | + Add to cart |
|
|
Product description
Defensin HNP-1 (human) trifluoroacetate salt,CAS : 148093-65-6 from ruixi. It is a kind of Antimicrobial peptide. It can be applied to Antimicrobial & Antiviral Peptides.
Appearance | N/A |
---|---|
Molecular weight | N/A |
Purity | >90% |
Solubility | N/A |
Cas | 148093-65-6 |
Sequence | ACYCRIPACIAGERRYGTCIYQGRLWAFCC |
Synonyms | ACYCRIPACIAGERRYGTCIYQGRLWAFCC |
Molecular Formula | C₁₅₀H₂₂₂N₄₄O₃₈S₆ |
Storage | -20℃, protected from light and moisture |
Transportation | 4-25℃ temperature for up to 3 weeks |
Stability | 1 year |
Document
Related Product